PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_34B6145E5.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 783aa    MW: 86347.1 Da    PI: 6.8521
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_34B6145E5.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.92.6e-09468510347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            +WT eE e + +  + +G++ +++I++ ++ ++t  +c+++++k+
  Traes_1AS_34B6145E5.3 468 PWTHEEKEVFMQMLASFGKN-FSKISNFLQ-HKTTADCVEFYYKH 510
                            8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.83E-15451513IPR009057Homeodomain-like
PROSITE profilePS5129314.727464515IPR017884SANT domain
SMARTSM007172.2E-8465513IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-7467512IPR009057Homeodomain-like
PfamPF002496.3E-7467510IPR001005SANT/Myb domain
PROSITE profilePS5129310.718675722IPR017884SANT domain
SMARTSM007172.5676724IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-6679716IPR009057Homeodomain-like
CDDcd001670.00466684715No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
LLPSRLTAVP EDKSCELTTN TVTVSNKDIP GAEVQAYNDE IPIKLGQLDG DRIGSLANVL  60
AELLQHEDSC SGDSRRLTNS SKLLLLKENI ARELEKTELE IDLLECELKS VSTESENKAL  120
EDAQNPSPSS GTSKTLAKPA TSKVLAKPET SKVLAMPEIC GTSSSPKEQG VLTPCKLSVG  180
QEADANGVDL MDVVTAPVRS VTAVSSGESV ACPGVVAEAQ VAVAADVAPL KPSEGTGSEI  240
DAHCLTPEPG LSHDNVSSMK ADGSNALSTR QCSQHIDSHN LIPSIIAVNN DIAKEFNELV  300
FKPLPYGQPC LGLSSEMKND LSVRKKLGIH KNRLRFKEQA LTFKFKVLRH LWKEDVRLLS  360
VRKQRPKSNK RTDQSNRASQ SGSQRQRSSN RSRLGMPAGN LSTFPTTEIS DVANKMFTEF  420
QFKRCRNYLK MPALIIDEKE KESASFVSKN GLIEDPVSVE KERSVINPWT HEEKEVFMQM  480
LASFGKNFSK ISNFLQHKTT ADCVEFYYKH HKSDSFREVK KLLDLRQQQP TGNYLGTKSG  540
KKWNPENAAS LDMLGNAASV VAAHGLDYAN RVEKDTAKSI IRTSCRSDVS AVAKGSLDKD  600
GIANVSLHER ESVAADVLAG ICGTLSPEGM GSCITSSADH GQKIGATRME YLIATPEADK  660
SFDEEDDLSD QECEVDSVDW YDNEKSLFIE ALNNHGKDFA RISSYVKSKS YEQCKVMPVE  720
VGVILTRHVL LKWILLFVAH SLLWKWRWKF VLLLIKPFRG IFYLVSPLNS QKLIDQMGQI  780
LWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-16426517494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-16426517494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLW4ZVH80.0W4ZVH8_WHEAT; Uncharacterized protein
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-63MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]